Cagrilintide is a long-acting amylin analog with a C20 fatty diacid on the N-terminal lysine.
Purity, content and identity from $250 per vial. Endotoxin, sterility and heavy metals at Gold and Elite. Results in 3 to 5 business days; sterility 14 days.
1415456-99-3
C194H312N54O59S2
4409 g/mol (monoisotopic 4406.25)
Lipidated, disulfide-cyclized peptide
Sequence: KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH2, 37 residues; disulfide Cys2-Cys7; Lys1 acylated with gamma-Glu and a C20 fatty diacid; C-terminal amide
Other names: NN9838, LM-28; component of CagriSema
The FDA GSRS calculated weight (3955) omits the lipid; the PubChem value is for the full molecule.
Every level includes purity, quantity, identity and a solubility check. Pick the level that matches what you need to know.
Purity and quantity by reversed-phase HPLC with the detector matched to the compound, identity against a reference standard, solubility check. 1 vial.
Purity, quantity and identity are reported in 3 to 5 business days after the samples are logged in. Sterility adds a 14-day incubation, and you get a preliminary COA while it runs. The COA carries a QR code that opens the current version of the report on verifiedbyvanguard.com.
Start an order online, or send the compound name and the tests you need for a quote.
