LL-37

LL-37 is the 37-residue human cathelicidin antimicrobial peptide.

Purity, content and identity from $250 per vial. Endotoxin, sterility and heavy metals at Gold and Elite. Results in 3 to 5 business days; sterility 14 days.

Compound data

Sequence and names

Sequence: [LL-37, 37 aa], 37 residues; UniProt P49913 residues 134-170

Other names: Ropocamptide, cathelicidin LL-37, CAP-18 fragment

How we test it

Every level includes purity, quantity, identity and a solubility check. Pick the level that matches what you need to know.

Silver

$250

Purity and quantity by reversed-phase HPLC with the detector matched to the compound, identity against a reference standard, solubility check. 1 vial.

Gold

$550

Silver plus endotoxin (USP 85) and sterility (USP 71). 3 vials.

Elite

$700

Gold plus heavy metals by ICP-MS and a fentanyl screen. 4 vials.

Test details

Purity and quantity, Identity, LC-MS identity, Endotoxin, Sterility, Heavy metals, Fentanyl screen, Conformity.

Turnaround and reporting

Purity, quantity and identity are reported in 3 to 5 business days after the samples are logged in. Sterility adds a 14-day incubation, and you get a preliminary COA while it runs. The COA carries a QR code that opens the current version of the report on verifiedbyvanguard.com.

Sources

https://pubchem.ncbi.nlm.nih.gov/compound/16198951 https://www.uniprot.org/uniprotkb/P49913/entry

Order

Start an order online, or send the compound name and the tests you need for a quote.

All peptide testing